PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006120P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 287aa    MW: 32604.4 Da    PI: 6.1769
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006120P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEdell++++k+  g+ +W++ ++  g+ R++k+c++rw +yl
   MELO3C006120P1 14 KGPWTSEEDELLINYIKENNGHgSWRSLPKLAGLLRCGKSCRLRWTNYL 62
                     79****************98888**********99************97 PP

2Myb_DNA-binding50.74.1e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
   MELO3C006120P1  68 RGPFTPEEEKLVIQLHGILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 113
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-23565IPR009057Homeodomain-like
PROSITE profilePS5129414.653962IPR017930Myb domain
SuperFamilySSF466891.98E-2811109IPR009057Homeodomain-like
SMARTSM007171.1E-101364IPR001005SANT/Myb domain
PfamPF002491.6E-131462IPR001005SANT/Myb domain
CDDcd001679.71E-91662No hitNo description
PROSITE profilePS5129425.54263117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2666117IPR009057Homeodomain-like
SMARTSM007174.6E-1567115IPR001005SANT/Myb domain
PfamPF002494.3E-1568113IPR001005SANT/Myb domain
CDDcd001677.17E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTSE EDELLINYIK ENNGHGSWRS LPKLAGLLRC GKSCRLRWTN  60
YLRPDIKRGP FTPEEEKLVI QLHGILGNRW AAIASQLPGR TDNEIKNLWN THLKKRLLCI  120
GIDPQTHEPF NSRCSSSTAP ASPATRHMAQ WESARLEAEA RLSRESSLFT PLLMDRTTDS  180
DFFLQIWNSE VGESFRRCRE DKTTCQSQSP LSSSVKSMES NNENEETEYK NFQSMTDIVM  240
SKSDSSSANE FEESSDSALG LLLDFPINND MSFLEEDNRN TQQHLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121175108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004133870.10.0PREDICTED: transcription repressor MYB6
SwissprotQ50EX64e-65ODO1_PETHY; Protein ODORANT1
TrEMBLA0A061E1591e-143A0A061E159_THECC; Myb domain protein 17 isoform 1
STRINGPOPTR_0014s07700.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-117myb domain protein 17